Community discussions

MikroTik App
 
arges
just joined
Topic Author
Posts: 19
Joined: Wed Aug 20, 2008 11:40 pm

Webproxy account Logging Problem

Thu Jan 20, 2011 5:52 pm

hi all,

Logging problem that;

2010.06.12-20:21:27: web-proxy,account 10.30.0.29 POST http://gateway.messenger.hotmail.com/ga ... otmail.com action=allow cache=MISS
2010.06.12-20:21:27: web-proxy,account 10.30.0.29 POST http://gateway.messenger.hotmail.com/ga ... otmail.com action=allow cache=MISS
2010.06.12-20:21:27: web-proxy,account 10.30.0.29 POST http://gateway.messenger.hotmail.com/ga ... otmail.com action=allow cache=MISS
2010.06.12-20:21:27: web-proxy,account 10.30.0.29 POST http://gateway.messenger.hotmail.com/ga ... otmail.com action=allow cache=MISS
2010.06.12-20:21:27: web-proxy,account 10.30.0.29 POST http://gateway.messenger.hotmail.com/ga ... otmail.com action=allow cache=MISS
2010.06.12-20:21:27: web-proxy,account 10.30.0.29 POST http://gateway.messenger.hotmail.com/ga ... otmail.com action=allow cache=MISS
2010.06.12-20:21:27: web-proxy,account 10.30.0.29 POST http://gateway.messenger.hotmail.com/ga ... otmail.com action=allow cache=MISS
2010.06.12-20:21:28: web-proxy,account 10.30.0.29 POST http://gateway.messenger.hotmail.com/ga ... otmail.com action=allow cache=MISS
2010.06.12-20:21:28: web-proxy,account 10.30.0.29 POST http://gateway.messenger.hotmail.com/ga ... otmail.com action=allow cache=MISS
2010.06.12-20:21:28: web-proxy,account 10.30.0.29 POST http://gateway.messenger.hotmail.com/ga ... otmail.com action=allow cache=MISS
2010.06.12-20:21:28: web-proxy,account 10.30.0.29 POST http://gateway.messenger.hotmail.com/ga ... otmail.com action=allow cache=MISS
2010.06.12-20:21:28: web-proxy,account 10.30.0.29 POST http://gateway.messenger.hotmail.com/ga ... otmail.com action=allow cache=MISS
2010.06.12-20:21:28: web-proxy,account 10.30.0.29 POST http://gateway.messenger.hotmail.com/ga ... otmail.com action=allow cache=MISS
2010.06.12-20:21:28: web-proxy,account 10.30.0.29 POST http://gateway.messenger.hotmail.com/ga ... otmail.com action=allow cache=MISS
2010.06.12-20:21:31: web-proxy,account 10.30.0.29 POST http://gateway.messenger.hotmail.com/ga ... otmail.com action=allow cache=MISS
2010.06.12-20:21:31: web-proxy,account 10.30.0.29 POST http://gateway.messenger.hotmail.com/ga ... otmail.com action=allow cache=MISS
2010.06.12-20:21:31: web-proxy,account 10.30.0.29 POST http://gateway.messenger.hotmail.com/ga ... otmail.com action=allow cache=MISS

if i could know, i don't want mikrotik to send POST action to remote log,

thx.
 
User avatar
sergejs
MikroTik Support
MikroTik Support
Posts: 6630
Joined: Thu Mar 31, 2005 3:33 pm
Location: Riga, Latvia
Contact:

Re: Webproxy account Logging Problem

Tue Jan 25, 2011 11:59 am

MikroTik proxy is not sending any posts messages by itself.
Your client is sending some post information to hotmail.com.
 
arges
just joined
Topic Author
Posts: 19
Joined: Wed Aug 20, 2008 11:40 pm

Re: Webproxy account Logging Problem

Thu Jan 27, 2011 10:45 pm

MikroTik proxy is not sending any posts messages by itself.
Your client is sending some post information to hotmail.com.
ok i know that, but i don't want mikrotik device to send this POST action to DUDE server.
those Logs are making lots network traffik, and it's not important to know users Post action
 
fewi
Forum Guru
Forum Guru
Posts: 7734
Joined: Tue Aug 11, 2009 3:19 am

Re: Webproxy account Logging Problem

Thu Jan 27, 2011 10:54 pm

Stop logging web-proxy messages, then.
Specific answers require specific questions. When in doubt, post the output of "/ip address print detail", "/ip route print detail", "/interface print detail", "/ip firewall export", and an accurate network diagram.
 
deveros
just joined
Posts: 2
Joined: Wed Sep 02, 2009 9:47 am

Re: Webproxy account Logging Problem

Tue Mar 27, 2012 10:40 pm

Sorry for my English

Mikrotik show me the log when its not connected to any one computer.
There is only antenna (NanoBridgeM) -> Mikrotik and nothing more, and LOG is still a lot of package,
and so all the days exchange data

plz help my

[aurimas@MikroTik] > log print
22:24:01 web-proxy,account 117.27.138.68 GET http://search.yahoo.com/search;_ylt=A0oG7nLNE3JPsXYAJ2hXNyoA?p=send+message+gamecube+c
ontroller+black&ei=UTF-8&fr=FP-tab-web-t&sm=Yahoo%21+Search&xargs=0&pstart=1&b=191&xa=n4GvXwqSqMeGjvgnMFPrzA--,1332962637  action=a
llow cache=MISS 
22:24:01 web-proxy,account 61.160.232.215 CONNECT http://cas.sdo.com:443  action=allow cache=MISS 
22:24:01 web-proxy,account 125.96.44.19 GET http://c.baidu.com/c.gif?t=0&q=%BB%B3%D4%D0%D7%F6%D7%EE%BC%D1%CA%B1%BC%E4&p=0&pn=1  act
ion=allow cache=MISS 
22:24:01 web-proxy,account 109.169.76.10 GET http://www.networkongame.com/games/handhistory/?sRoundReference=R5-228314462-1  action
=allow cache=MISS 
22:24:01 web-proxy,account 78.46.181.215 GET http://summorum-pontificum.de/  action=allow cache=MISS 
22:24:01 web-proxy,account 94.189.251.179 POST http://95.211.143.200/io/login  action=allow cache=MISS 
22:24:01 web-proxy,account 91.121.35.209 CONNECT http://visitvalue.6degres.fr  action=allow cache=MISS 
22:24:01 web-proxy,account 208.109.97.231 GET http://googleads.g.doubleclick.net/mads/gma?submodel=iPhone&u_h=480&prl=5293&js=afma-
sdk-i-v4.0.2&format=320x50_mb&u_sd=1&preqs=1&u_so=p&platform=iPhone%20C1&net=wi&app_name=1.0.iphone.com.moonground.moonstones.f act
ion=allow cache=MISS 
22:24:02 web-proxy,account 222.186.59.103 GET http://www.hztw007.com/  action=allow cache=MISS 
22:24:02 web-proxy,account 125.96.44.19 GET http://www.ip138.com/ip2city.asp  action=allow cache=MISS 
22:24:02 web-proxy,account 124.126.190.106 GET http://sclick.baidu.com/w.gif?q=%D7%F6%C8%CB%C1%F7%C4%C4%B8%F6%D2%BD%D4%BA%BA%C3&fm=
as&F=778717EA&F1=9D73F1E4&F2=4CA6BD6B&F3=54E5242F&T=1332876230&title=%E5%8C%97%E4%BA%AC%E6%97%A0%E7%97%9B%E4%BA%BA%E6%B5%81%E5% act
ion=allow cache=MISS 
22:24:02 web-proxy,account 124.126.129.205 GET http://www.ip138.com/ip2city.asp  action=allow cache=MISS 
22:24:02 web-proxy,account 111.73.45.232 GET http://app.igame.qq.com/cgi-bin/v1.0/im/cgi_get_game_info.cgi?gid=0&uin=1784502700&rd=
0.8996289194999039  action=allow cache=MISS 
22:24:02 web-proxy,account 60.217.32.27 GET http://jnlfhg88.com/prod_view.asp?ID=1445  action=allow cache=MISS 
22:24:02 web-proxy,account 87.226.105.100 CONNECT http://64.12.202.43:443  action=allow cache=MISS 
22:24:02 web-proxy,account 125.96.43.150 GET http://ip138.com/ip2city.asp  action=allow cache=MISS 
22:24:02 web-proxy,account 60.169.75.163 GET http://www.163kan.com/  action=allow cache=MISS 
22:24:02 web-proxy,account 125.96.44.19 GET http://suggestion.baidu.com/su?wd=%E6%97%A9%E6%97%A9%E5%AD%95%E8%AF%95%E7%BA%B8%E6%9C%8
0%E6%97%A9%E4%BB%80%E4%B9%88%E6%97%B6%E5%80%99%E7%94%A8+%E6%88%90%E9%83%BD%E4%B9%9D%E9%BE%99%E5%8C%BB%E9%99%A2%E5%9B%BD%E9%99%8 act
ion=allow cache=MISS 
22:24:02 web-proxy,account 184.154.33.218 GET http://itunes.apple.com/ca/app/id318445496?mt=8  action=allow cache=MISS 
22:24:02 web-proxy,account 184.22.84.37 GET http://www.xm778899.com/search.asp?q=%E5%8A%9E%E8%AF%81  action=allow cache=MISS 
22:24:03 web-proxy,account 77.20.25.227 GET http://www.ersties.com/login.php  action=allow cache=MISS 
22:24:03 web-proxy,account 83.149.3.2 GET http://images.google.com/  action=allow cache=MISS 
22:24:03 web-proxy,account 125.96.44.19 GET http://ip138.com/ip2city.asp  action=allow cache=MISS 
22:24:03 web-proxy,account 109.123.116.170 CONNECT http://google.com  action=allow cache=MISS 
22:24:03 web-proxy,account 95.191.11.133 GET http://go.jetswap.com/ssf.php?m=3&sh=0&code=159&v=1&nrf=1&ah=1&sid=155672&owner=228734
&nv=2.0.0.45&h=80647a5dbbc4c25e76e3ca844908b33e&dmd=5c44f313b1ed026a9ec9d6130b52ee76  action=allow cache=MISS 
22:24:03 web-proxy,account 114.244.205.224 GET http://c.baidu.com/c.gif?t=0&q=%B3%AF%D1%F4%C7%F8%B1%A3%BD%E0%B9%AB%CB%BE%C3%C0%B6%F
9%C3%C0%B1%A3%BD%E0&p=0&pn=1  action=allow cache=MISS 
22:24:03 web-proxy,account 118.22.74.134 GET http://ameblo.jp/hirosiz  action=allow cache=MISS 
22:24:03 web-proxy,account 41.35.69.102 GET http://images.google.com/  action=allow cache=MISS 
22:24:03 web-proxy,account 221.2.63.76 POST http://gubapost10.eastmoney.com/look_post.aspx?code=600019&id=10503449009&action=addrev
iew&key=add  action=allow cache=MISS 
22:24:03 web-proxy,account 117.21.191.230 GET http://member.union.soso.com/CustomPage.php?dt=1332876229046&unc=j400485&ch=2%2C3%2C4
%2C5%2C6%2C7%2C8&h=80&w=950&pro=s1&med=a1&color_bg=%23E9F7FD&color_bdr=%237FABD1&btn_pos=0&kw_pos=0&kw_num=3&kw_color=%230033CC act
ion=allow cache=MISS 
22:24:03 web-proxy,account 77.20.25.227 POST http://www.ersties.com/login.php  action=allow cache=MISS 
22:24:03 web-proxy,account 208.109.97.231 GET http://googleads.g.doubleclick.net/mads/gma?submodel=iPhone&u_h=480&prl=6817&js=afma-
sdk-i-v4.0.2&format=320x50_mb&u_sd=1&preqs=12&u_so=p&platform=iPhone%20C1&net=wi&app_name=1.0.3.iphone.com.hanamobile.app.retin act
ion=allow cache=MISS 
22:24:03 web-proxy,account 86.198.168.153 GET http://images.google.com/  action=allow cache=MISS 
22:24:03 web-proxy,account 125.212.38.212 CONNECT http://205.188.251.47:443  action=allow cache=MISS 
22:24:03 web-proxy,account 176.9.172.164 CONNECT http://www.filbet.com  action=allow cache=MISS 
22:24:04 web-proxy,account 61.191.190.130 GET http://app.igame.qq.com/cgi-bin/v1.0/im/cgi_get_game_info.cgi?gid=0&uin=530256361&rd=
0.8996289194999039  action=allow cache=MISS 
22:24:04 web-proxy,account 60.169.75.163 GET http://www.163kan.com/  action=allow cache=MISS 
22:24:04 web-proxy,account 125.96.43.150 GET http://www.ip138.com/ip2city.asp  action=allow cache=MISS 
22:24:04 web-proxy,account 80.80.3.130 GET http://www.airblue.com/index.asp  action=allow cache=MISS 
22:24:04 web-proxy,account 213.87.143.160 GET http://images.google.com/  action=allow cache=MISS 
22:24:04 web-proxy,account 125.96.44.19 GET http://www.baidu.com/  action=allow cache=MISS 
22:24:04 web-proxy,account 184.22.84.37 GET http://www.xm778899.com/  action=allow cache=MISS 
22:24:04 web-proxy,account 124.126.129.205 GET http://www.baidu.com/  action=allow cache=MISS 
22:24:04 web-proxy,account 188.72.230.151 GET http://wordstat.yandex.ru/?cmd=words&page=1&text=%22%D1%81%D0%BA%D0%B0%D1%87%D0%B0%D1
%82%D1%8C+%D1%82%D0%B5%D0%BC%D1%8B+%D1%81%D0%BE%D0%BD%D0%B8+%D1%8D%D1%80%D0%B8%D0%BA%D1%81%D0%BE%D0%BD+%D0%BA550%22  action=deny 
22:24:04 web-proxy,account 125.96.44.19 GET http://www.ip138.com/ip2city.asp  action=allow cache=MISS 
22:24:04 web-proxy,account 222.186.27.87 GET http://ptlogin2.qq.com/check?uin=197749922&appid=8000202&r=0.7693505102168395  action=
allow cache=MISS 
22:24:04 web-proxy,account 60.217.32.27 GET http://www.weitansitehg.com/plus/search.php?keyword=22  action=allow cache=MISS 
22:24:04 web-proxy,account 125.212.38.212 CONNECT http://64.12.202.43:443  action=allow cache=MISS 
22:24:04 web-proxy,account 124.126.129.205 GET http://www.baidu.com/  action=allow cache=MISS 
22:24:04 web-proxy,account 58.51.95.194 GET http://www.52gqq.com/  action=allow cache=MISS 
22:24:04 web-proxy,account 125.96.44.17 GET http://suggestion.baidu.com/su?wd=%E7%94%9F%E6%AE%96%E5%99%A8%E7%96%B1%E7%96%B9%E7%97%8
7%E7%8A%B6&p=3&cb=window.bdsug.sug&t=1332876239437  action=allow cache=MISS 
22:24:04 web-proxy,account 184.154.124.234 POST http://i.w.inmobi.com/showad.asm  action=allow cache=MISS 
22:24:04 web-proxy,account 117.27.138.68 GET http://search.yahoo.com/search;_ylt=A0oG7nLRE3JPx14A9jJXNyoA?p=send+message+gamecube+c
ontroller+black&ei=UTF-8&fr=FP-tab-web-t&sm=Yahoo%21+Search&xargs=0&pstart=1&b=201&xa=R2cptv8MLbvhPIzWyEzEOQ--,1332962641  action=a
llow cache=MISS 
22:24:04 web-proxy,account 125.96.43.62 GET http://www.baidu.com/s?bs=%D2%CB%B1%F6%CC%E5%BC%EC%C4%C4%C0%EF%BA%C3&f=8&wd=%D2%CB%B1%F
6%CC%E5%BC%EC%C4%C4%C0%EF%BA%C3+%D2%CB%B1%F6%D5%FD%BD%A1%C6%BD%BC%DB%D2%BD%B1%A3%B6%A8%B5%E3%D2%BD%D4%BA  action=allow cache=MISS 
22:24:05 web-proxy,account 188.72.230.151 GET http://wordstat.yandex.ru/?cmd=words&page=1&text=%22%D1%81%D0%BA%D0%B0%D1%87%D0%B0%D1
%82%D1%8C+%D1%82%D0%B5%D0%BC%D1%8B+%D1%81%D0%BE%D0%BD%D0%B8+%D1%8D%D1%80%D0%B8%D0%BA%D1%81%D0%BE%D0%BD+%D0%BA550%22  action=deny 
22:24:05 web-proxy,account 118.22.74.134 GET http://ameblo.jp/sizenhousoku/  action=allow cache=MISS 
22:24:05 web-proxy,account 124.126.190.106 GET http://suggestion.baidu.com/su?wd=%E5%81%9A%E4%BA%BA%E6%B5%81%E5%93%AA%E4%B8%AA%E5%8
C%BB%E9%99%A2%E5%A5%BD+%E5%8C%97%E4%BA%AC&p=3&cb=window.bdsug.sug&t=1332876242761  action=allow cache=MISS 
22:24:05 web-proxy,account 111.73.45.232 GET http://app.igame.qq.com/cgi-bin/v1.0/im/cgi_get_game_info.cgi?gid=0&uin=380056782&rd=0
.8996289194999039  action=allow cache=MISS 
22:24:05 web-proxy,account 125.65.45.68 GET http://tc.ph.affinity.com/s20_tc.php?&cmpubid=dvu47&cmsite=www.pathba.com&cmchannelid=&
cmurl=http%3A%2F%2Fwww.pathba.com%2F2011%2F04%2FpathBA-driver-database-goes-live.html&cmref=&cmoe=&cmoq=&cmvd=89200&cmvc=null&c act
ion=allow cache=MISS 
22:24:05 web-proxy,account 108.163.244.154 GET http://www.livenation.com/event/0C00486C85556EF7?artistid=1645840&majorcatid=10001&m
inorcatid=1  action=allow cache=MISS 
22:24:05 web-proxy,account 114.244.205.224 GET http://suggestion.baidu.com/su?wd=%E6%9C%9D%E9%98%B3%E5%8C%BA%E4%BF%9D%E6%B4%81&p=3&
cb=window.bdsug.sug&t=1332876219031  action=allow cache=MISS 
22:24:05 web-proxy,account 173.212.242.83 GET http://66.196.107.227/config/login?login=krungthepmahanakornamornratanakosinmahintara
yutthayamahadilokphopnopparatrajathaniburiromudomrajaniwesmahasatharnamornphimarnavatarnsathitsakkattiyavisanukamprasit_&passwd act
ion=allow cache=MISS 
22:24:05 web-proxy,account 86.198.168.153 GET http://www.baidu.com/  action=allow cache=MISS 
22:24:05 web-proxy,account 125.96.44.19 GET http://www.baidu.com/s?bs=%D4%E7%D4%E7%D4%D0%CA%D4%D6%BD%D7%EE%D4%E7%CA%B2%C3%B4%CA%B1%
BA%F2%D3%C3++&f=8&wd=%D4%E7%D4%E7%D4%D0%CA%D4%D6%BD%D7%EE%D4%E7%CA%B2%C3%B4%CA%B1%BA%F2%D3%C3+%B3%C9%B6%BC%BE%C5%C1%FA%D2%BD%D4 act
ion=allow cache=MISS 
22:24:05 web-proxy,account 108.163.250.146 CONNECT http://www.ticketmaster.com:443  action=allow cache=MISS 
22:24:05 web-proxy,account 177.33.18.179 GET http://images.google.com/  action=allow cache=MISS 
22:24:05 web-proxy,account 188.72.230.151 GET http://wordstat.yandex.ru/?cmd=words&page=1&text=%22%D1%81%D0%BA%D0%B0%D1%87%D0%B0%D1
%82%D1%8C+%D1%82%D0%B5%D0%BC%D1%8B+%D1%81%D0%BE%D0%BD%D0%B8+%D1%8D%D1%80%D0%B8%D0%BA%D1%81%D0%BE%D0%BD+%D0%BA550%22  action=deny 
22:24:05 web-proxy,account 117.21.191.230 GET http://www.soso.com/q?w=%CC%EC%C3%A8%BD%AB%CD%C6%CA%D3%C6%B5%B9%BA%CE%EF%BC%BC%CA%F5&
unc=j400485_s1_a1&cid=union.s.wh  action=allow cache=MISS 
22:24:05 web-proxy,account 78.46.70.136 GET http://www.denic.de/webwhois/?domain=freiheitlich.de  action=allow cache=MISS 
22:24:05 web-proxy,account 125.96.43.84 GET http://sclick.baidu.com/w.gif?q=%D6%CE%C1%C6%B8%CE%B8%B9%CB%AE%C6%AB%B7%BD&fm=se&T=1332
876156&y=F7DD8BBE&path=http://www.baidu.com/s?wd=%D6%CE%C1%C6%B8%CE%B8%B9%CB%AE%C6%AB%B7%BD&cid=0&qid=b351e91d2789b455&t=133287 act
ion=allow cache=MISS 
22:24:06 web-proxy,account 109.95.73.236 CONNECT http://www.ea.com:443  action=allow cache=MISS 
22:24:06 web-proxy,account 125.65.45.96 GET http://udmserve.net/udm/img.fetch?sid=4746;tid=2;ev=1;dt=2;  action=allow cache=MISS 
22:24:06 web-proxy,account 221.122.5.146 GET http://www4.ipdl.inpit.go.jp/TD/web006/20120328042401111106.htm  action=allow cache=MI
SS 
22:24:06 web-proxy,account 125.212.38.212 CONNECT http://64.12.202.59:443  action=allow cache=MISS 
22:24:06 web-proxy,account 125.96.44.19 GET http://www.baidu.com/  action=allow cache=MISS 
22:24:06 web-proxy,account 188.72.230.151 GET http://wordstat.yandex.ru/?cmd=words&page=1&text=%22%D1%81%D0%BA%D0%B0%D1%87%D0%B0%D1
%82%D1%8C+%D1%82%D0%B5%D0%BC%D1%8B+%D1%81%D0%BE%D0%BD%D0%B8+%D1%8D%D1%80%D0%B8%D0%BA%D1%81%D0%BE%D0%BD+%D0%BA550%22  action=deny 
22:24:06 web-proxy,account 46.251.237.226 GET http://l08.member.bf1.yahoo.com/config/pwtoken_get?login=bigbird_&src=ygodgw&passwd=6
dfb7ebaf1918bbd36469230926b6ce9&challenge=TkD4.ZMKj_EvEj0N8glo4G6Le6UI&md5=1  action=allow cache=MISS 
22:24:06 web-proxy,account 184.154.33.218 GET http://itunes.apple.com/fr/app/id385685211?mt=8  action=allow cache=MISS 
22:24:06 web-proxy,account 109.169.76.10 GET http://www.networkongame.com/games/handhistory/?sRoundReference=R5-228314463-1  action
=allow cache=MISS 
22:24:06 web-proxy,account 76.164.223.115 GET http://68.142.241.128/config/login?login=sirfkb@xtra.co.nz&passwd=abc123  action=allo
w cache=MISS 
22:24:06 web-proxy,account 125.96.43.150 GET http://www.baidu.com/  action=allow cache=MISS 
22:24:06 web-proxy,account 125.96.44.19 GET http://c.baidu.com/c.gif?t=0&q=%D4%E7%D4%D0%CA%D4%D6%BD%20%B3%C9%B6%BC%BE%C5%C1%FA%D2%B
D%D4%BA%B9%FA%BC%CA%D2%BD%C1%C6%C6%BD%BC%DB%CA%D5%B7%D1&p=0&pn=1  action=allow cache=MISS 
22:24:06 web-proxy,account 72.227.187.95 GET http://images.google.com/  action=allow cache=MISS 
22:24:06 web-proxy,account 1.202.102.192 GET http://suggestion.baidu.com/su?wd=%E6%80%A5%E6%80%A7%E5%BF%83%E8%82%8C%E6%A2%97%E5%A1%
9E+%E6%8E%A8%E8%8D%90%E5%8C%97%E4%BA%AC%E6%AD%A6%E8%AD%A6%E6%80%BB%E9%98%9F%E5%8C%BB%E9%99%A2%E5%BF%83%E8%84%91%E8%A1%80%E7%AE% act
ion=allow cache=MISS 
22:24:07 web-proxy,account 78.46.70.136 GET http://www.denic.de/webwhois/?domain=kri.de  action=allow cache=MISS 
22:24:07 web-proxy,account 201.236.64.2 GET http://217.12.8.36/config/pwtoken_get?login=_fire#123&src=ygodgw&passwd=a57d07668f25f0e
4bc5c6a2c5269aaca&challenge=zmvceW5wj_F8x4Uf2YPKAWd9qtQb&md5=1  action=allow cache=MISS 
22:24:07 web-proxy,account 125.96.43.150 GET http://ip138.com/ip2city.asp  action=allow cache=MISS 
22:24:07 web-proxy,account 124.126.132.146 GET http://suggestion.baidu.com/su?wd=%E6%88%90%E9%83%BD%E9%98%B4%E9%81%93%E7%B4%A7%E7%B
C%A9+%E6%88%90%E9%83%BD%E4%B9%9D%E9%BE%99%E8%BF%BD&p=3&cb=window.bdsug.sug&t=1332876231828  action=allow cache=MISS 
22:24:07 web-proxy,account 1.202.102.192 GET http://ip138.com/ip2city.asp  action=allow cache=MISS 
22:24:07 web-proxy,account 192.168.0.116 GET http://notify6.dropbox.com/subscribe?host_int=161144842&ns_map=14133257_2083073271817&
ts=1332876244  action=allow cache=MISS 
22:24:07 web-proxy,account 124.126.133.41 GET http://cache.baidu.com/c?m=9f65cb4a8c8507ed4fece763105786711923c1386084c7150885ce1784
642c101b7bb9ec747c565ecec57e6401b8492ae8f02172410124aa98ca8f4fdcbb9923299f27432a5ad91f069644ef9d4932b0278729e8b868e3ad833484d8d act
ion=allow cache=MISS 
22:24:07 web-proxy,account 95.191.11.133 GET http://go.jetswap.com/safeimage.php?sid=155672&owner=228734&sh=395928290  action=allow
 cache=MISS 
22:24:07 web-proxy,account 61.160.232.215 CONNECT http://cas.sdo.com:443  action=allow cache=MISS 
22:24:07 web-proxy,account 95.191.11.133 GET http://zadartepotov.narod.ru/1/4.html  action=deny 
22:24:07 web-proxy,account 84.75.28.23 GET http://www.google.com/safebrowsing/diagnostic?site=http://www.fraggingmouse.com/razer-or
ochi-review  action=allow cache=MISS 
22:24:07 web-proxy,account 46.53.195.33 GET http://images.google.com/  action=allow cache=MISS 
22:24:07 web-proxy,account 93.175.120.204 CONNECT http://jannek-zechner.com  action=allow cache=MISS 
22:24:07 web-proxy,account 66.90.103.107 GET http://www.google.com/search?as_q=mexic+%22Powered+by+WordPress%22&num=100&hl=en&outpu
t=ie&filter=0  action=allow cache=MISS 
22:24:07 web-proxy,account 124.126.129.205 GET http://suggestion.baidu.com/su?wd=%E5%8C%97%E4%BA%AC%E4%B8%89%E7%94%B2%E7%94%B7%E7%A
7%91%E5%8C%BB%E9%99%A2%E6%8E%92%E5%90%8D&p=3&cb=window.bdsug.sug&t=1332876247200  action=allow cache=MISS 
22:24:07 web-proxy,account 60.217.32.27 GET http://pufenghg.com/prod_view.asp?ID=3  action=allow cache=MISS 
22:24:07 web-proxy,account 125.96.44.17 GET http://ip138.com/ip2city.asp  action=allow cache=MISS 
22:24:07 web-proxy,account 125.96.44.17 GET http://www.baidu.com/s?wd=%C9%FA%D6%B3%C6%F7%F0%E5%D5%EE%D6%A2%D7%B4  action=allow cach
e=MISS 
22:24:08 web-proxy,account 184.154.44.178 GET http://ads.mp.mydas.mobi/getAd.php5?medialets=false&sdkapid=59295&auid=5rqvsmj38x9ifk
ygoso7nn59skhy1d3ni5ztvqmg&mmisdk=4.2.6-11.6.13.i&ua=iPhone%204.3.0&dv=4.3.0&dm=iPhone2,1&adtype=MMBannerAdTop&hswd=320&hsht=53 act
ion=allow cache=MISS 
 
grizly
just joined
Posts: 20
Joined: Thu Nov 29, 2012 2:15 am
Location: Melbourne/Australia

Re: Webproxy account Logging Problem

Wed Jul 24, 2013 9:28 am

You have an open proxy chief.. block the internet from accessing your proxy server!
/ip firewall filter
add chain=input in-interface=<Your WAN Port> protocol=tcp dst-port=8080 action=drop

Who is online

Users browsing this forum: No registered users and 17 guests